tirth8205/code-review-graph

Pythoncode-review-graph.com

Local-first code intelligence graph for MCP and CLI. Builds a persistent map of your codebase so AI coding tools read only what matters, with benchmarked context reductions on reviews and large-repo workflows.

ai-codingclaudeclaude-codecode-reviewgraphragincrementalknowledge-graphllmmcppythonstatic-analysistree-sitter
Croissance des étoiles
Étoiles
31.3k
Forks
2.8k
Croissance hebdomadaire
+189
Issues
87
10k20k30k
mars 26mai 26juil. 26sept. 26
ArtefactsPyPI
README

code-review-graph

tirth8205%2Fcode-review-graph | Trendshift

Stop burning tokens. Start reviewing smarter.

English | 简体中文 | 日本語 | 한국어 | हिन्दी

PyPI Downloads Stars MIT Licence CI Python 3.10+ MCP Website Discord

Usage · Commands · FAQ · Troubleshooting · GitHub Action · Reproducing the benchmarks · Roadmap


AI coding tools can end up re-reading large parts of your codebase on review tasks. code-review-graph fixes that. It builds a structural map of your code with Tree-sitter, tracks changes incrementally, and gives your AI assistant precise context via MCP so it reads only what matters.

The Token Problem: reading flask's whole corpus costs 143,594 tokens, a graph answer costs 2,196 — 71.0x fewer


Quick Start

pip install code-review-graph                     # or: pipx install code-review-graph
code-review-graph install          # auto-detects and configures all supported platforms
code-review-graph build            # parse your codebase

One command sets up everything. install detects which AI coding tools you have, writes the correct MCP configuration for each one, installs platform-native hooks/skills where supported, and injects graph-aware instructions into your platform rules. It auto-detects whether you installed via uvx or pip/pipx and generates the right config. Restart your editor/tool after installing.

One Install, Every Platform: auto-detects Codex, Claude Code, CodeBuddy Code, Cursor, Windsurf, Zed, Continue, OpenCode, Antigravity, Gemini CLI, Qwen, Qoder, Kiro, GitHub Copilot, and GitHub Copilot CLI

To target a specific platform:

code-review-graph install --platform codex       # configure only Codex
code-review-graph install --platform cursor      # configure only Cursor
code-review-graph install --platform claude-code  # configure only Claude Code
code-review-graph install --platform gemini-cli   # configure only Gemini CLI
code-review-graph install --platform antigravity   # configure only Antigravity
code-review-graph install --platform windsurf     # configure only Windsurf
code-review-graph install --platform zed          # configure only Zed
code-review-graph install --platform continue     # configure only Continue
code-review-graph install --platform opencode     # configure only OpenCode
code-review-graph install --platform qwen         # configure only Qwen
code-review-graph install --platform qoder        # configure only Qoder
code-review-graph install --platform kiro         # configure only Kiro
code-review-graph install --platform copilot      # configure only GitHub Copilot (VS Code)
code-review-graph install --platform copilot-cli  # configure only GitHub Copilot CLI
code-review-graph install --platform codebuddy    # configure only CodeBuddy Code
code-review-graph install --platform hermes       # configure only Hermes Agent

Requires Python 3.10+. For the best experience, install uv (the MCP config will use uvx if available, otherwise falls back to the code-review-graph command directly).

To remove CRG from a Git or SVN project, use the symmetric uninstall command from anywhere inside its working tree. The target is normalized to the working tree root, and non-repository directories are refused. It removes only CRG-owned files and entries; unrelated MCP servers, hooks, skills, and JSONC comments remain untouched. Shared configuration changes use atomic replacement so a failed write leaves the original file intact.

code-review-graph uninstall --dry-run    # preview every action; write nothing
code-review-graph uninstall              # preview, ask for confirmation, then apply
code-review-graph uninstall --yes        # apply without prompting
code-review-graph uninstall --all-repos  # also clean every registered repository
code-review-graph uninstall --keep-data  # remove integrations but keep graph databases
code-review-graph uninstall --keep-user-configs --repo .  # clean this project only

Then open your project and ask your AI assistant:

Build the code review graph for this project

The initial build takes ~10 seconds for a 500-file project. After that, watch mode and supported hooks can keep the graph updated automatically.

How It Works

How your AI assistant uses the graph: User asks for review, AI checks MCP tools, graph returns blast radius and risk scores, AI reads only what matters

Your repository is parsed into an AST with Tree-sitter, stored as a graph of nodes (functions, classes, imports) and edges (calls, inheritance, test coverage), then queried at review time to compute the minimal set of files your AI assistant needs to read.

Architecture pipeline: Repository to Tree-sitter Parser to SQLite Graph to Blast Radius to Minimal Review Set

Blast-radius analysis

When a file changes, the graph traces every caller, dependent, and test that could be affected. This is the "blast radius" of the change. Your AI reads only these files instead of scanning the whole project.

Blast radius visualization showing how a change to login() propagates to callers, dependents, and tests

Incremental updates in seconds

When hooks or watch mode are enabled, file saves and supported commit hooks trigger incremental updates. The graph diffs changed files, finds their dependents through the graph's own import and call edges, and re-parses only the files whose SHA-256 hash actually changed. On a ~3,000-file project (django) a two-file edit re-indexes in about 2.5 seconds on the path the hooks use, of which ~1.4 s is process start-up; a no-op update costs only that start-up. See Incremental update latency for the full measurement.

Incremental update flow: a supported hook or watch update triggers a git diff, dependents are found through graph edges, and only files whose SHA-256 hash changed are re-parsed

Whole codebase or targeted answer?

The bigger the repository, the more token waste hurts. Instead of feeding a whole corpus to the model, the graph returns an answer-shaped slice of it: on this repository, 208,821 source tokens become ~3,190 tokens per question.

code-review-graph repo: 208,821 source tokens funnel down to ~3,190 token graph responses — 68x fewer tokens per question

Broad language coverage + Jupyter notebooks

Language coverage organized by category: Web, Backend, Systems, Mobile, Scripting, Shells, Domain, and Other, plus Jupyter and Databricks notebook support

Parser support covers functions, classes, imports, call sites, inheritance, and test detection across the current parser surface, using Tree-sitter where available and targeted fallbacks where needed. Current support includes Python, JavaScript/TypeScript/TSX, Go, Rust, Java, C/C++, C#, VB.NET, Ruby, Kotlin, Swift, PHP, Scala, Solidity, Dart, R, Perl, Lua/Luau, Objective-C, shell scripts, Elixir, Zig, PowerShell, Julia, ReScript, GDScript, Nix, Verilog/SystemVerilog, SQL, Terraform/OpenTofu structure (.tf; generic .hcl files are recognized as file nodes), Ansible playbooks/roles/tasks, Vue/Svelte SFCs, Astro files parsed through the TypeScript parser, Jupyter/Databricks notebooks (.ipynb), and Perl XS files (.xs). Generic YAML is not treated as source code.

PHP projects additionally get repository-bounded Composer PSR-4 resolution, Blade template references, and Laravel Route/Eloquent semantic edges when the source includes explicit framework imports, model inheritance, and receiver evidence.

Add your own language (no fork needed)

If your repo uses a language the parser does not cover yet, drop a languages.toml into .code-review-graph/ mapping file extensions to any grammar bundled in tree_sitter_language_pack, plus the tree-sitter node types for functions, classes, imports, and calls:

[languages.erlang]
extensions = [".erl"]
grammar = "erlang"
function_node_types = ["function_clause"]
class_node_types = ["record_decl"]
import_node_types = ["import_attribute"]
call_node_types = ["call"]

The generic tree-sitter walker handles extraction from there — no code changes, and built-in languages can never be overridden. See docs/CUSTOM_LANGUAGES.md for the schema reference, validation rules, and a worked end-to-end example.

Risk-scored PR reviews in CI (GitHub Action)

The same analysis runs as a composite GitHub Action — and it stays local-first: the knowledge graph is built and queried entirely on your CI runner, with no source code sent to any external service. On each pull request the action posts a single sticky comment with risk-scored functions, affected execution flows, and test gaps, updated in place on every push. An optional fail-on-risk input turns the review into a merge gate.

# .github/workflows/code-review-graph.yml
on:
  pull_request:

permissions:
  contents: read
  pull-requests: write

jobs:
  review:
    runs-on: ubuntu-latest
    steps:
      - uses: actions/checkout@v7
      - uses: tirth8205/code-review-graph@v2.3.6
        with:
          github-token: ${{ secrets.GITHUB_TOKEN }}

See docs/GITHUB_ACTION.md for inputs, risk levels, and caching details, or the dogfood workflow this repo runs on itself in .github/workflows/pr-review.yml.


Benchmarks

Benchmarks across 6 real repositories: ~65x median per-question token reduction (376x max), 0.69 average impact F1 against graph-derived ground truth

Headline number: the median per-question token reduction across the 6 repos is ~65x (whole-corpus baseline vs graph query). The 376x maximum is a single best-case repo (fastapi, the largest corpus) — not the typical result.

All numbers come from the automated evaluation runner against 6 real open-source repositories (13 commits total). Every config pins an upstream SHA, the Leiden community detector runs with a fixed seed, and embeddings are deterministic on CPU — so two runs on different machines produce identical numbers. The full reproduction recipe with expected outputs is in docs/REPRODUCING.md. A weekly report-only run on the two smallest configs lives in .github/workflows/eval.yml.

Token efficiency: ~65x median per-question reduction (range 36x – 376x; whole-corpus vs graph query)

For a typical agent question ("how does authentication work", "what is the main entry point", etc.), the graph returns ~2,000–3,500 tokens of targeted search hits + neighbor edges instead of forcing the agent to read every source file. The table below averages over the 5 sample questions defined in code_review_graph/token_benchmark.py.

Repo Snapshot SHA naive_corpus_tokens avg graph_tokens Reduction
fastapi 22381558 948,793 2,653 375.6x
flask a29f88ce 143,594 2,196 71.0x
code-review-graph 84bde354 208,821 3,190 68.1x
gin 5c00df8a 166,868 2,766 61.9x
httpx b55d4635 142,356 2,661 60.6x
express b4ab7d65 136,052 3,936 36.0x

Median per-question reduction across the 6 repos: ~65x. The range is 36x – 376x, where 376x is the best case (fastapi, the largest corpus), not the headline.

Re-captured 2026-08-02 from clean clones at the pinned SHAs (crg 2.3.7, local all-MiniLM-L6-v2 embeddings). These numbers are lower than the 2026-05-25 capture they replace: the graph response grew as node embedding text became richer, so avg graph_tokens rose across every repo. fastapi is now measured at its current pin 22381558 rather than the retired 0227991a.

The whole-corpus baseline above is an upper bound no real agent pays: a competent agent greps for identifiers and reads only the best-matching files. The agent_baseline eval benchmark measures that realistic baseline — a pure-python grep over the corpus, top-3 files by match count, token-counted and compared to the graph query cost (evaluate/results/<repo>_agent_baseline_*.csv).

The formal eval/benchmarks/token_efficiency.py benchmark measures a different scenario — full get_review_context() JSON versus just the changed-file content of a commit — and reports ratios below 1 for small commits, because the review-context response carries impact-radius edges plus source snippets that exceed a tiny single-file diff. That is not a bug; the two benchmarks answer different questions. See docs/REPRODUCING.md for the full methodology.

Since v2.3.4, review and impact tools attach a compact context_savings estimate so MCP clients can see the approximate context saved per call. In v2.3.5 the CLI surfaces this as the boxed Token Savings panel shown above (see "Token Savings panel" in the Usage section) and adds --verify to cross-check against OpenAI's cl100k_base tokenizer. Calibration data in docs/REPRODUCING.md shows the estimate is within ~1% of real GPT-4 tokens in aggregate across 222 sample files.

Impact accuracy: 0.69 average F1 against graph-derived ground truth (recall 1.0 is a circular upper bound, not "100% recall")

Blast-radius analysis recovers every file in the ground truth on all 13 evaluation commits — but read that as an upper bound, not as "100% recall": in this mode the ground truth (changed files + files with call/import edges into them) is derived from the same graph the predictor traverses, so it is circular by construction. The over-prediction visible in the precision column is a deliberate trade-off: better to flag too many files than miss a broken dependency.

Repo Commits Avg F1 Avg Precision Recall (graph-derived upper bound)
httpx 2 0.863 0.785 1.0
code-review-graph 2 0.734 0.584 1.0
fastapi 2 0.697 0.539 1.0
express 2 0.667 0.500 1.0
flask 2 0.633 0.485 1.0
gin 3 0.609 0.439 1.0
Average 13 0.693 0.546 1.000

The benchmark also runs an honest co-change mode: the predictor is seeded with a single changed file and graded against the other files the author actually touched in the same commit — independent-ish evidence from git history, not from the graph. Both modes appear side by side in the result CSVs (ground_truth_mode column). As of the 2026-08-02 capture that mode returns predicted_files = 0 on every graded commit, so it is not yet a usable measurement and no co-change number is quoted here — the harness needs fixing before the mode says anything about accuracy.

Build performance
Repo Files Nodes Edges Flow Detection Search Latency
express 141 1,910 17,553 106ms 0.7ms
fastapi 1,122 6,285 27,117 128ms 1.5ms
flask 83 1,446 7,974 95ms 0.7ms
gin 99 1,286 16,762 111ms 0.5ms
httpx 60 1,253 7,896 96ms 0.4ms

Limitations and known weaknesses

  • Impact "recall 1.0" is graph-derived and circular: the historical ground truth comes from the same graph edges the predictor walks, so it is an upper bound by construction. The honest co-change mode (grade against files actually co-changed in the same commit) is measured alongside it; expect those numbers to be substantially lower.
  • Small single-file changes: Graph context can exceed naive file reads for trivial edits (see express results above). The overhead is the structural metadata that enables multi-file analysis.
  • Search quality (MRR 0.35): Keyword search finds the right result in the top-4 for most queries, but ranking needs improvement. Express queries return 0 hits due to module-pattern naming.
  • Flow detection (33% recall): Framework and conventional entry patterns are strongest for Python and PHP/Laravel. JavaScript and Go flow detection needs work.
  • Precision vs recall trade-off: Impact analysis is deliberately conservative. It flags files that might be affected, which means some false positives in large dependency graphs.

Features

Feature Details
Incremental updates Re-parses only the files whose hash changed. On a ~3,000-file repo a two-file edit takes ~2.5s on the hook path (measured).
Broad language + notebook support Python, JavaScript/TypeScript/TSX, Go, Rust, Java, C/C++, C#, VB.NET, Ruby, Kotlin, Swift, PHP, Scala, Solidity, Dart, R, Perl, Lua/Luau, Objective-C, shell scripts, Elixir, Zig, PowerShell, Julia, ReScript, GDScript, Nix, Verilog/SystemVerilog, SQL, Terraform/OpenTofu structure (.tf; generic .hcl files are file-only), Ansible playbooks/roles/tasks, Vue/Svelte SFCs, Astro files parsed through the TypeScript parser, Jupyter/Databricks (.ipynb), and Perl XS (.xs)
Framework-aware PHP parsing Repository-bounded Composer PSR-4 imports, Blade template references, and evidence-gated Laravel Route-to-controller and Eloquent relationship edges
Blast-radius analysis Shows which functions, classes, and files are likely affected by a change
Auto-update hooks Hooks and watch mode can update the graph on file saves and supported commit hooks
Semantic search Optional vector embeddings via sentence-transformers, Google Gemini, MiniMax, Voyage AI, or any OpenAI-compatible endpoint (real OpenAI, Azure, new-api, LiteLLM, vLLM, LocalAI)
Interactive visualisation D3.js force-directed graph with search, community legend toggles, and degree-scaled nodes
Hub & bridge detection Find most-connected nodes and architectural chokepoints via betweenness centrality
Surprise scoring Detect unexpected coupling: cross-community, cross-language, peripheral-to-hub edges
Knowledge gap analysis Identify isolated nodes, untested hotspots, thin communities, and structural weaknesses
Suggested questions Auto-generated review questions from graph analysis (bridges, hubs, surprises)
Edge confidence Three-tier confidence scoring (EXTRACTED/INFERRED/AMBIGUOUS) with float scores on edges
Graph traversal Free-form BFS/DFS exploration from any node with configurable depth and token budget
Export formats GraphML (Gephi/yEd), Neo4j Cypher, Obsidian vault with wikilinks, SVG static graph
Graph diff Compare graph snapshots over time: new/removed nodes, edges, community changes
Token benchmarking Measure naive full-corpus tokens vs graph query tokens with per-question ratios
Estimated context savings Compact context_savings metadata on relevant MCP/CLI review outputs, labelled as estimated and kept to three small fields
Memory loop Persist Q&A results as markdown for re-ingestion, so the graph grows from queries
Community auto-split Oversized communities (>25% of graph) are recursively split via Leiden
Execution flows Trace call chains from entry points, sorted by weighted criticality
Community detection Cluster related code via Leiden algorithm with resolution scaling for large graphs
Architecture overview Auto-generated architecture map with coupling warnings
Risk-scored reviews detect_changes maps diffs to affected functions, flows, and test gaps
Custom languages Add new languages via .code-review-graph/languages.toml — no fork or code changes needed
GitHub Action Sticky risk-scored PR review comments in CI, with an optional fail-on-risk merge gate
Refactoring tools Rename preview, framework-aware dead code detection, community-driven suggestions
Wiki generation Auto-generate markdown wiki from community structure
Multi-repo registry Register multiple repos, search across all of them
Multi-repo daemon crg-daemon watches multiple repos as child processes, with health checks and auto-restart
MCP prompts 5 workflow templates: review, architecture, debug, onboard, pre-merge
Full-text search FTS5-powered hybrid search combining keyword and vector similarity
Local storage SQLite file in .code-review-graph/. Core graph storage needs no external database or cloud service.
Watch mode Continuous graph updates as you work

Usage

Slash commands
Command Description
/code-review-graph:build-graph Build or rebuild the code graph
/code-review-graph:review-delta Review changes since last commit
/code-review-graph:review-pr Full PR review with blast-radius analysis
CLI reference
code-review-graph install          # Auto-detect and configure all platforms
code-review-graph install --platform <name>  # Target a specific platform
code-review-graph uninstall --dry-run  # Preview safe removal of installed artifacts
code-review-graph build            # Parse entire codebase
code-review-graph update           # Incremental update (changed files only)
code-review-graph status           # Graph statistics
code-review-graph watch            # Auto-update on file changes
code-review-graph visualize        # Generate interactive HTML graph
code-review-graph visualize --format json      # Export local graph data as JSON
code-review-graph visualize --format graphml   # Export as GraphML
code-review-graph visualize --format svg       # Export as SVG
code-review-graph visualize --format obsidian  # Export as Obsidian vault
code-review-graph visualize --format cypher    # Export as Neo4j Cypher
code-review-graph wiki             # Generate markdown wiki from communities
code-review-graph detect-changes --brief         # Risk panel + token savings (read-only)
code-review-graph update --brief                 # Refresh graph + same panel
code-review-graph detect-changes --brief --verify  # Cross-check vs tiktoken
code-review-graph register <path>  # Register repo in multi-repo registry
code-review-graph unregister <id>  # Remove repo from registry
code-review-graph repos            # List registered repositories
code-review-graph daemon start     # Start multi-repo watch daemon
code-review-graph daemon stop      # Stop the daemon
code-review-graph daemon status    # Show daemon status and repos
code-review-graph eval             # Run evaluation benchmarks
code-review-graph serve            # Start MCP server

JSON exports stay inside the local graph data directory, which Git ignores by default. They can contain absolute paths and code-structure metadata, so inspect and sanitize an export before publishing it outside your machine.

Token Savings panel: detect-changes --brief vs update --brief

Both commands print the same compact panel showing how many tokens the graph saved you compared to handing the changed files to an agent raw. They differ in one thing: whether the graph gets refreshed first.

┌─────────────────────── Token Savings ────────────────────────┐
│ Full context would be:     12,921 tokens                     │
│ Graph context used:           762 tokens                     │
│ Saved:                     12,159 tokens (~94%)              │
│ Breakdown: Functions 244 · Tests 191 · Risk 244 · Other 83   │
└──────────────────────────────────────────────────────────────┘
Command What it does When to use
detect-changes --brief Read-only. Looks at your current changes, queries the existing graph, prints the panel. ~1 sec. Most of the time — the hooks (or crg-daemon) keep the graph fresh in the background, so this is enough.
update --brief Re-parses your changed files into the graph first, then prints the same panel. ~5 sec. After a rebase, a large change set, or any time you suspect the graph is stale.

Both end with the same panel because both call the same analyze_changes() step at the end. The difference is whether the graph itself got refreshed before that analysis ran.

Add --verify to either command to cross-check the displayed numbers against OpenAI's cl100k_base tokenizer (the GPT-4 family). Requires pip install tiktoken. The estimate stays within ~1% of real tokens on a typical change set — see docs/REPRODUCING.md for the calibration data.

The same context_savings metadata is also attached automatically to the JSON responses of get_impact_radius, get_review_context, detect_changes, and get_architecture_overview MCP tools, so AI agents can surface the savings to humans in chat without any extra prompting.

Multi-repo daemon

If your editor doesn't support hooks (e.g. Cursor, OpenCode), or you just want your graph to stay fresh in the background without any editor integration, the daemon is for you. It watches your repos for file changes and automatically rebuilds the graph — no manual build or update commands needed.

The daemon is included with code-review-graph — no separate install required.

Quick setup:

# 1. Register the repos you want to watch
crg-daemon add ~/project-a --alias proj-a
crg-daemon add ~/project-b

# 2. Start the daemon (runs in the background)
crg-daemon start

# 3. That's it — graphs stay up to date automatically
crg-daemon status                 # check daemon and per-repo watcher status
crg-daemon logs --repo proj-a -f  # tail logs for a specific repo
crg-daemon stop                   # stop daemon and all watcher processes

Also available as code-review-graph daemon start|stop|status|....

Under the hood, crg-daemon add writes to a TOML config file at ~/.code-review-graph/watch.toml. You can also edit this file directly:

[[repos]]
path = "/home/user/project-a"
alias = "proj-a"

[[repos]]
path = "/home/user/project-b"
alias = "project-b"

The daemon monitors this config file for changes and automatically starts/stops watcher processes as repos are added or removed. Health checks every 30 seconds restart dead watchers. No external dependencies required.

See docs/COMMANDS.md for the full config reference and all available options.

30 MCP tools

Your AI assistant uses these automatically once the graph is built.

Tool Description
build_or_update_graph_tool Build or incrementally update the graph
run_postprocess_tool Re-run flow detection, community detection, and FTS indexing
get_minimal_context_tool Ultra-compact context (~100 tokens) — call this first
get_impact_radius_tool Blast radius of changed files
get_review_context_tool Token-optimised review context with structural summary
query_graph_tool Callers, callees, tests, imports, inheritance queries
traverse_graph_tool BFS/DFS traversal from any node with token budget
semantic_search_nodes_tool Search code entities by name or meaning
embed_graph_tool Compute vector embeddings for semantic search
list_graph_stats_tool Graph size and health
get_docs_section_tool Retrieve documentation sections
find_large_functions_tool Find functions/classes exceeding a line-count threshold
list_flows_tool List execution flows sorted by criticality
get_flow_tool Get details of a single execution flow
get_affected_flows_tool Find flows affected by changed files
list_communities_tool List detected code communities
get_community_tool Get details of a single community
get_architecture_overview_tool Architecture overview from community structure
detect_changes_tool Risk-scored change impact analysis for code review
get_hub_nodes_tool Find most-connected nodes (architectural hotspots)
get_bridge_nodes_tool Find chokepoints via betweenness centrality
get_knowledge_gaps_tool Identify structural weaknesses and untested hotspots
get_surprising_connections_tool Detect unexpected cross-community coupling
get_suggested_questions_tool Auto-generated review questions from analysis
refactor_tool Rename preview, dead code detection, suggestions
apply_refactor_tool Apply a previously previewed refactoring
generate_wiki_tool Generate markdown wiki from communities
get_wiki_page_tool Retrieve a specific wiki page
list_repos_tool List registered repositories
cross_repo_search_tool Search across all registered repositories

MCP Prompts (5 workflow templates): review_changes, architecture_map, debug_issue, onboard_developer, pre_merge_check

Configuration

To exclude paths from indexing, create a .code-review-graphignore file in your repository root:

generated/**
*.generated.ts
vendor/**
node_modules/**

Note: in git repos, only tracked files are indexed (git ls-files), so gitignored files are skipped automatically. Use .code-review-graphignore to exclude tracked files or when git isn't available.

Optional dependency groups:

pip install "code-review-graph[embeddings]"          # Local vector embeddings (sentence-transformers)
pip install "code-review-graph[google-embeddings]"   # Google Gemini embeddings
pip install "code-review-graph[communities]"         # Community detection (igraph)
pip install "code-review-graph[enrichment]"          # Python call-resolution enrichment (Jedi)
pip install "code-review-graph[eval]"                # Evaluation benchmarks (matplotlib)
pip install "code-review-graph[wiki]"                # Wiki generation with LLM summaries (ollama)
pip install "code-review-graph[all]"                 # All optional dependencies

Environment Variables

Variable Description Default
CRG_GIT_TIMEOUT Timeout in seconds for Git operations 30
CRG_DATA_DIR Override directory for graph databases and generated graph artefacts -
CRG_EMBEDDING_MODEL Default model for vector embeddings all-MiniLM-L6-v2
CRG_ACCEPT_CLOUD_EMBEDDINGS Suppress the cloud embedding egress warning after explicit acknowledgement -
CRG_ALLOW_REMOTE_CODE Allow HuggingFace models that require trust_remote_code=True 0
CRG_MAX_IMPACT_NODES Maximum nodes to include in impact analysis 500
CRG_MAX_IMPACT_DEPTH Search depth for blast-radius analysis 2
CRG_MAX_BFS_DEPTH Maximum depth for graph traversal 15
CRG_MAX_CHANGED_FUNCS Maximum changed functions analysed in one change report 500
CRG_MAX_TRANSITIVE_FRONTIER Maximum frontier size for transitive caller/callee expansion 50
CRG_TOOL_TIMEOUT Optional timeout in seconds for bounded MCP tools (0 disables timeout) 0
CRG_RECURSE_SUBMODULES Include git submodules in file collection when set to 1, true, or yes -
CRG_TOOLS Comma-separated allowlist of MCP tools to expose when serving -
GOOGLE_API_KEY API key for Google Gemini embeddings -
MINIMAX_API_KEY API key for MiniMax embeddings -
VOYAGE_API_KEY API key for Voyage embeddings -
CRG_VOYAGE_MODEL Model name for Voyage embeddings voyage-code-3
CRG_VOYAGE_OUTPUT_DIMENSION Output dimension for Voyage embeddings 1024
CRG_VOYAGE_OUTPUT_DTYPE Output dtype for Voyage embeddings float
CRG_VOYAGE_BASE_URL Voyage embeddings endpoint https://api.voyageai.com/v1
CRG_VOYAGE_BATCH_SIZE Batch size for Voyage embedding requests 100
CRG_VOYAGE_MIN_INTERVAL_SEC Minimum delay between Voyage requests 0
CRG_OPENAI_BASE_URL OpenAI-compatible embeddings endpoint -
CRG_OPENAI_API_KEY API key for OpenAI-compatible embeddings -
CRG_OPENAI_MODEL Model name for OpenAI-compatible embeddings -
CRG_OPENAI_DIMENSION Pin embedding dimension (v3 models support reduction) -
NO_COLOR If set, disables ANSI colors in terminal -
CRG_SERIAL_PARSE If 1, disables parallel parsing (use for debugging) -

OpenAI-compatible embeddings (real OpenAI, Azure, or any self-hosted gateway like new-api / LiteLLM / vLLM / LocalAI / Ollama in openai mode) need no extra install — just set the environment variables and pass provider="openai" to embed_graph:

export CRG_OPENAI_BASE_URL=http://127.0.0.1:3000/v1     # or https://api.openai.com/v1
export CRG_OPENAI_API_KEY=sk-...
export CRG_OPENAI_MODEL=text-embedding-3-small          # whatever your gateway serves
# optional:
export CRG_OPENAI_DIMENSION=1536                        # pin dim (v3 models support reduction)
export CRG_OPENAI_BATCH_SIZE=100                        # lower for gateways with tight limits
                                                        # (e.g. Qwen text-embedding-v4 caps at 10)

The cloud-egress warning is auto-skipped when the base URL points to localhost (127.0.0.1, localhost, 0.0.0.0, ::1).

Voyage embeddings need no extra install. Set VOYAGE_API_KEY and pass provider="voyage" to embed_graph; the default model is voyage-code-3:

export VOYAGE_API_KEY=pa-...
export CRG_ACCEPT_CLOUD_EMBEDDINGS=1
code-review-graph embed --provider voyage --model voyage-code-3

Model selection tip. Avoid -preview / -beta / -exp model IDs (e.g. google/gemini-embedding-2-preview) for anything you plan to keep long-term — preview models can change weights (different dimension → full re-embed required) or be deprecated without notice. Prefer stable GA releases such as text-embedding-3-small / text-embedding-3-large (OpenAI), Qwen/Qwen3-Embedding-8B (via self-hosted vLLM / LocalAI), or gemini-embedding-001 (via the native Gemini provider, which requires GOOGLE_API_KEY instead of the OpenAI-compatible path).

code-review-graph embeds identifiers, signatures, structural context, and a bounded first-paragraph docstring/doc-comment summary. It does not transmit function bodies. Graphs created before documentation extraction was added need one full code-review-graph build before re-embedding so every file is reparsed. Routine builds never refresh embeddings by default. To refresh an existing index after a build, explicitly pass both --embedding-provider and --embedding-model; cloud choices may transmit this source-derived text and incur API cost.

Tool Filtering

CRG exposes 30 MCP tools by default. In token-constrained environments, you can limit the server to a subset of tools using --tools or the CRG_TOOLS environment variable:

# Via CLI flag
code-review-graph serve --tools query_graph_tool,semantic_search_nodes_tool,detect_changes_tool

# Via environment variable
CRG_TOOLS=query_graph_tool,semantic_search_nodes_tool code-review-graph serve

The CLI flag takes precedence over the environment variable. When neither is set, all tools are available. This is especially useful for MCP client configurations:

{
  "mcpServers": {
    "code-review-graph": {
      "command": "code-review-graph",
      "args": ["serve", "--tools", "query_graph_tool,semantic_search_nodes_tool,detect_changes_tool,get_review_context_tool"]
    }
  }
}

FAQ & how it compares

Short, honest answers in docs/FAQ.md:

Troubleshooting

pip / pipx cannot download hatchling (or Errno 9 / Bad file descriptor to PyPI)

Installing from a source tree (for example pipx install .) needs build dependencies from PyPI (for example hatchling). If you see Could not find a version that satisfies the requirement hatchling after connection warnings, the Python/pip in that terminal may not be able to open an HTTPS client to pypi.org (sometimes seen in an integrated editor terminal; less often system-wide with VPN, firewall, or proxy).

Options:

  1. Run the same command from macOS Terminal.app (or iTerm) instead of the IDE’s terminal, then retry pipx install . or pipx install "git+https://..." .

  2. Use uv to install the CLI from a checkout (uses different download machinery than pip in many cases):

    cd /path/to/code-review-graph
    uv tool install . --force
    
  3. For development in a clone without a global install, use uv sync and uv run code-review-graph … (or activate .venv after uv sync).

Diagnose (optional): python3 scripts/diagnose_pypi_connectivity.py — if it prints FAILED, the issue is environment/network, not a wrong package name in this repo.

Windows Configuration Issues (Invalid JSON / Connection Closed)

If you are using Windows and encounter Invalid JSON: EOF while parsing or MCP error -32000: Connection closed when connecting via Claude Code, do not use the cmd /c wrapper in your config.

Ensure fastmcp is updated to at least 3.2.4+. Then, configure your ~/.claude.json to execute the .exe directly and pass the UTF-8 environment variable via the config:

"code-review-graph": {
  "command": "C:\\path\\to\\your\\venv\\Scripts\\code-review-graph.exe",
  "args": ["serve", "--repo", "C:\\path\\to\\your\\project"],
  "env": { "PYTHONUTF8": "1" }
}

Contributing

git clone https://github.com/tirth8205/code-review-graph.git
cd code-review-graph
python3 -m venv .venv && source .venv/bin/activate
pip install -e ".[dev]"
pytest
Adding a new language

Edit code_review_graph/parser.py and add your extension to EXTENSION_TO_LANGUAGE along with node type mappings in _CLASS_TYPES, _FUNCTION_TYPES, _IMPORT_TYPES, and _CALL_TYPES. Include a test fixture and open a PR.

Licence

MIT. See LICENSE.


code-review-graph.com

pip install code-review-graph && code-review-graph install
Works with Codex, Claude Code, CodeBuddy Code, Cursor, Windsurf, Zed, Continue, OpenCode, Antigravity, Gemini CLI, Qwen, Qoder, Kiro, GitHub Copilot, GitHub Copilot CLI, and Hermes Agent

Dépôts similaires
rtk-ai/rtk

CLI proxy that reduces LLM token consumption by 60-90% on common dev commands. Single Rust binary, zero dependencies

Rustcrates.iocliApache License 2.0agentic-codingai-coding
rtk-ai.app
79.6k5k
sickn33/agentic-awesome-skills

AAS Core is the local, agent-first control plane for complete catalog discovery, agent-owned selection, stack validation, and planning, backed by 2,115+ agentic skills. Includes CLI, local MCP, catalog, plugins, and Workbench.

PythonPyPIskillMIT Licenseagentic-skillsai-agents
sickn33.github.io/agentic-awesome-skills/
46.2k6.7k
medusajs/medusa

The world's most flexible commerce platform for agents and developers

TypeScriptnpmlibraryOthernodejsmedusa
medusajs.com
36.2k5.2k
esengine/DeepSeek-Reasonix

DeepSeek-native AI coding agent for your terminal. Engineered around prefix-cache stability — leave it running.

GoGo ModulescliMIT Licenseagentagent-framework
reasonix.io
35.5k2.4k
oraios/serena

A powerful MCP toolkit for coding, providing semantic retrieval and editing capabilities - the IDE for your agent

PythonPyPIMIT Licenseagentai
oraios.github.io/serena
29k2k
QwenLM/qwen-code

An open-source AI coding agent that lives in your terminal.

TypeScriptnpmcliApache License 2.0agenticai
qwenlm.github.io/qwen-code-docs/en/users/overview
27.7k3k
Kilo-Org/kilocode

Kilo is the all-in-one agentic engineering platform. Build, ship, and iterate faster with the most popular open source coding agent.

TypeScriptnpmcliMIT Licenseai-codingvscode
kilo.ai
27.2k3.1k
superset-sh/superset

Superset is an agentic IDE to orchestrate 100+ coding agents in parallel. Run any agent with your own subscription.

TypeScriptnpmcliOtherclaude-codecodex
superset.sh
14k1.3k
zilliztech/claude-context

Code search MCP for Claude Code. Make entire codebase the context for any coding agent.

TypeScriptnpmMIT Licenseagentagentic-rag
github.com/zilliztech/claude-context/tree/master/docs
12.5k920
cobusgreyling/loop-engineering

Practical patterns, starters & CLI tools for loop engineering with AI coding agents. Design systems that prompt and orchestrate agents (inspired by Addy Osmani and Boris Cherny). Includes loop-audit, loop-init, loop-cost.

TypeScriptnpmMIT Licenseagentic-aiai-agents
cobusgreyling.github.io/loop-engineering/
11.1k1.5k
getagentseal/codeburn

Free, local tool to track AI coding token usage and cost across 37 tools and agents (Claude Code, Cursor, Codex, Gemini and more), by model, project, and task. npx codeburn

TypeScriptnpmcliMIT Licenseai-codingclaude-code
codeburn.app
10.9k816
automazeio/ccpm

Project management skill system for Agents that uses GitHub Issues and Git worktrees for parallel agent execution.

ShellMIT Licenseai-agentsai-coding
automaze.io
8.4k837