ランキングに戻る

zubair-trabzada/ai-marketing-claude

Pythonskool.com/aiworkshop

AI Marketing Suite for Claude Code. 15 marketing skills with parallel subagents — audit any website, generate copy, email sequences, ad campaigns, content calendars, competitive intelligence, and client-ready PDF reports.

ai-marketingclaudeclaude-codecompetitive-analysiscontent-strategycopywritingemail-marketingmarketingmarketing-automationseo
スター成長
スター
2.2k
フォーク
647
週間成長
Issue
3
1.5k2k
26年3月26年4月26年6月26年7月
成果物PyPIpip install ai-marketing-claude
README

AI Marketing Suite for Claude Code

AI Marketing Suite for Claude Code

A comprehensive marketing analysis and automation skill system for Claude Code. Audit any website's marketing, generate copy, build email sequences, create content calendars, analyze competitors, and produce client-ready PDF reports — all from your terminal.

Built for entrepreneurs, agency builders, and solopreneurs who want to sell marketing services powered by AI.


What This Does

Type a command in Claude Code and get instant, actionable marketing analysis:

> /market audit https://calendly.com

Launching 5 parallel agents...
✓ Content & Messaging Analysis     — Score: 72/100
✓ Conversion Optimization          — Score: 58/100
✓ SEO & Discoverability            — Score: 81/100
✓ Competitive Positioning          — Score: 64/100
✓ Brand & Trust                    — Score: 76/100
✓ Growth & Strategy                — Score: 61/100

Overall Marketing Score: 69/100

Full report saved to MARKETING-AUDIT.md

Installation

One-Command Install

curl -fsSL https://raw.githubusercontent.com/zubair-trabzada/ai-marketing-claude/main/install.sh | bash

Manual Install

git clone https://github.com/zubair-trabzada/ai-marketing-claude.git
cd ai-marketing-claude
./install.sh

Optional: PDF Report Support

pip install reportlab

Commands

Command What It Does
/market audit <url> Full marketing audit with 5 parallel agents
/market quick <url> 60-second marketing snapshot
/market copy <url> Generate optimized copy with before/after examples
/market emails <topic> Generate complete email sequences
/market social <topic> 30-day social media content calendar
/market ads <url> Ad creative and copy for all platforms
/market funnel <url> Sales funnel analysis and optimization
/market competitors <url> Competitive intelligence report
/market landing <url> Landing page CRO analysis
/market launch <product> Product launch playbook
/market proposal <client> Client proposal generator
/market report <url> Full marketing report (Markdown)
/market report-pdf <url> Professional marketing report (PDF)
/market seo <url> SEO content audit
/market brand <url> Brand voice analysis and guidelines

Architecture

ai-marketing-claude/
├── market/SKILL.md                     # Main orchestrator (routes all /market commands)
│
├── skills/                             # 14 sub-skills
│   ├── market-audit/SKILL.md           # Full audit orchestration
│   ├── market-copy/SKILL.md            # Copywriting analysis & generation
│   ├── market-emails/SKILL.md          # Email sequence generation
│   ├── market-social/SKILL.md          # Social media content calendar
│   ├── market-ads/SKILL.md             # Ad creative & copy
│   ├── market-funnel/SKILL.md          # Funnel analysis & optimization
│   ├── market-competitors/SKILL.md     # Competitive intelligence
│   ├── market-landing/SKILL.md         # Landing page CRO
│   ├── market-launch/SKILL.md          # Launch playbook generation
│   ├── market-proposal/SKILL.md        # Client proposal generator
│   ├── market-report/SKILL.md          # Marketing report (Markdown)
│   ├── market-report-pdf/SKILL.md      # Marketing report (PDF)
│   ├── market-seo/SKILL.md             # SEO content audit
│   └── market-brand/SKILL.md           # Brand voice analysis
│
├── agents/                             # 5 parallel subagents
│   ├── market-content.md               # Content & messaging analysis
│   ├── market-conversion.md            # CRO & funnel optimization
│   ├── market-competitive.md           # Competitive positioning
│   ├── market-technical.md             # Technical SEO & tracking
│   └── market-strategy.md              # Brand, pricing & growth strategy
│
├── scripts/                            # Python utility scripts
│   ├── analyze_page.py                 # Webpage marketing analysis
│   ├── competitor_scanner.py           # Competitor website scanner
│   ├── social_calendar.py              # Social content calendar generator
│   └── generate_pdf_report.py          # PDF report generator
│
├── templates/                          # Marketing templates
│   ├── email-welcome.md                # Welcome email sequence (5 emails)
│   ├── email-nurture.md                # Lead nurture sequence (6 emails)
│   ├── email-launch.md                 # Product launch sequence (8 emails)
│   ├── proposal-template.md            # Client proposal template
│   ├── content-calendar.md             # 30-day content calendar
│   └── launch-checklist.md             # Launch checklist
│
├── install.sh                          # One-command installer
├── uninstall.sh                        # Clean uninstaller
├── requirements.txt                    # Python dependencies
└── LICENSE                             # MIT License

Scoring Methodology

The full marketing audit scores websites across 6 dimensions:

Category Weight What It Measures
Content & Messaging 25% Copy quality, value props, headlines, CTAs
Conversion Optimization 20% Funnels, forms, social proof, friction, urgency
SEO & Discoverability 20% On-page SEO, technical SEO, content structure
Competitive Positioning 15% Differentiation, market awareness, alternatives
Brand & Trust 10% Design quality, trust signals, authority
Growth & Strategy 10% Pricing, acquisition channels, retention

Overall Marketing Score = Weighted average of all categories (0-100)


How It Works

  1. You type a command — e.g., /market audit https://example.com
  2. Claude reads the skill files — they tell Claude exactly how to analyze the site
  3. 5 subagents launch in parallel — each one analyzes a different dimension
  4. Python scripts run — automated page analysis, competitor scanning
  5. Results are compiled — into a scored, prioritized, actionable report
  6. Output is saved — as a Markdown file or professional PDF

Use Cases

For Agency Builders

  • Run /market audit on a prospect's website before a sales call
  • Generate /market proposal with specific findings and pricing
  • Deliver /market report-pdf as a professional client deliverable

For Solopreneurs

  • Use /market copy to optimize your own landing pages
  • Generate /market emails for your product launches
  • Build /market social calendars for consistent posting

For Content Creators

  • Research competitors with /market competitors
  • Plan launches with /market launch
  • Analyze your funnel with /market funnel

Uninstall

./uninstall.sh

Or manually:

rm -rf ~/.claude/skills/market*
rm -f ~/.claude/agents/market-*.md

Learn More

Want to learn how to build a marketing agency powered by AI tools like this?

Join the AI Workshop Community — Learn AI automations, vibe coding, and how to build AI-powered services for clients.


License

MIT License — see LICENSE for details.