랭킹으로 돌아가기

bug0inc/passmark

TypeScriptpassmark.dev

The open-source Playwright library for AI browser regression testing with intelligent caching, auto-healing, and multi-model verification.

aiai-agentsaigatewayaisdkplaywrightqaqa-automationvercelai-testingbrowser-testinge2e-testingqaautomation
스타 성장
스타
1.2k
포크
183
주간 성장
이슈
14
9001k1.1k1.2k
26년 4월26년 5월26년 6월26년 7월
아티팩트npmnpm install passmark
README

Passmark
The open-source Playwright library for AI regression testing.

Follow on X LinkedIn Website npm package version License

Passmark covers your browser regression testing end-to-end and helps you catch regressions early. Fast.

It uses AI models to execute natural language browser steps via Playwright, with intelligent caching, auto-healing, and multi-model assertion verification. Your tests stay stable without needing to update AI prompts or retrain models.

Quick Start

npm init playwright@latest passmark-project # select the default options and set language to TypeScript
cd passmark-project
npm install passmark

We need at least one model from Anthropic and one from Google to use Passmark's multi-model consensus features. Set the required environment variables in .env:

ANTHROPIC_API_KEY=sk-ant-...
GOOGLE_GENERATIVE_AI_API_KEY=AIza...

Alternatively, you can use an AI gateway like Vercel AI Gateway, OpenRouter, or OpenCode Zen to route requests to multiple providers without managing individual API keys. If you choose this option, set AI_GATEWAY_API_KEY (for Vercel), OPENROUTER_API_KEY (for OpenRouter), or OPENCODEZEN_API_KEY (for OpenCode Zen) instead.

You can also route requests through Cloudflare AI Gateway for observability, caching, and rate limiting. Unlike Vercel/OpenRouter/OpenCode Zen, Cloudflare is a proxy (not a reseller), so you still need your own ANTHROPIC_API_KEY / GOOGLE_GENERATIVE_AI_API_KEY alongside CLOUDFLARE_ACCOUNT_ID and CLOUDFLARE_AI_GATEWAY (and CLOUDFLARE_AI_GATEWAY_API_KEY if the gateway has authentication enabled).

Set your Playwright project to read .env by adding the following to playwright.config.ts (after import { defineConfig, devices } from '@playwright/test';):

import dotenv from 'dotenv';
import path from 'path';

dotenv.config({ path: path.resolve(__dirname, '.env') });

Make sure you install dotenv by running npm install dotenv.

Now, paste the following code into tests/example.spec.ts:

import { test, expect } from "@playwright/test";
import { runSteps } from "passmark";

test.use({
  headless: !!process.env.CI,
});

test("Shopping cart tests", async ({ page }) => {
  test.setTimeout(60_000); // increase timeout for AI execution
  await runSteps({
    page,
    userFlow: "Add product to cart",
    steps: [
      { description: "Navigate to https://demo.vercel.store" },
      { description: "Click Acme Circles T-Shirt" },
      { description: "Select color", data: { value: "White" } },
      { description: "Select size", data: { value: "S" } },
      { description: "Add to cart", waitUntil: "My Cart is visible" },
    ],
    assertions: [{ assertion: "You can see My Cart with Acme Circles T-Shirt" }],
    test,
    expect
  });
});

If you are using an AI gateway, you can add the following to the above code:

import { runSteps, configure } from "passmark";

configure({
  ai: {
    gateway: "vercel" // or "openrouter", "opencodezen", or "cloudflare"
    // Set AI_GATEWAY_API_KEY (Vercel), OPENROUTER_API_KEY (OpenRouter),
    // OPENCODEZEN_API_KEY (OpenCode Zen), or
    // CLOUDFLARE_ACCOUNT_ID + CLOUDFLARE_AI_GATEWAY (+ CLOUDFLARE_AI_GATEWAY_API_KEY
    // if the gateway is authenticated) in your .env file. Cloudflare also requires
    // the upstream provider keys (ANTHROPIC_API_KEY, GOOGLE_GENERATIVE_AI_API_KEY).
  }
});

To run the test, use:

npx playwright test example.spec.ts --project chromium

After the test completes, you can run npx playwright show-report to see a detailed report of the test execution, including an AI summary at the top, provided by Passmark.

Using CUA mode (OpenAI computer-use agent)

By default Passmark uses ARIA accessibility snapshots. For visual, screenshot-driven automation via OpenAI's computer-use agent, opt in with mode: "cua":

import { configure } from "passmark";

configure({
  ai: {
    mode: "cua",
    gateway: "none", // CUA requires direct OpenAI access
  },
});

Set OPENAI_API_KEY in your .env. Then you can write tests like this:

test("Shopping cart tests", async ({ page }) => {
  await runSteps({
    page,
    userFlow: "Add product to cart",
    steps: [
      { description: "Navigate to https://demo.vercel.store" },
      { description: "Click Acme Circles T-Shirt" },
      { description: "Select color", data: { value: "White" } },
      { description: "Add to cart", waitUntil: "My Cart is visible" },
    ],
    test,
    expect,
  });
});

Notes:

  • CUA mode uses OpenAI's gpt-5.5 + built-in computer tool. The CUA model is currently locked and not user-configurable.
  • Redis step caching is skipped in CUA mode because coordinate actions aren't portable across viewport sizes.
  • gateway: "vercel" | "openrouter" | "cloudflare" is not compatible with CUA — the Responses-API computer tool is only exposed on direct OpenAI access.
  • Account requirements: your OpenAI API key must have access to the CUA model and the built-in computer tool on the Responses API.

Per-step overrides (hybrid runs)

The same ai shape accepted by configure() can also be passed at the runSteps/runUserFlow call level and on individual Steps. This lets you mix snapshot steps (cheap, cacheable, OpenRouter/Vercel/etc.) with CUA steps (visual, direct OpenAI) in a single run. Precedence: step.ai ▶ call-level ai ▶ global configure().

configure({ ai: { gateway: "openrouter" } }); // most steps go through OpenRouter

await runSteps({
  page, test, expect,
  userFlow: "Buy product on sale",
  steps: [
    { description: "Navigate to /products" },                     // OpenRouter snapshot
    {
      description: "Drag the price slider to $40",
      ai: { mode: "cua", gateway: "none" },                       // CUA for this step only
    },
    { description: "Click Add to cart" },                         // back to OpenRouter snapshot
  ],
});

Set OPENAI_API_KEY whenever any step opts into mode: "cua". CUA steps still require gateway: "none"; mixing CUA with a non-none gateway throws at the per-step level for the same reason it does globally.

Features

  • Core ExecutionrunSteps() and runUserFlow() for flexible test orchestration in natural language, with smart caching and auto-healing
  • Multi-Model Assertion Engine — Consensus-based validation using Claude and Gemini, with an arbiter model to resolve disagreements
  • Video Assertions — Opt in per-assertion to record the full step run and evaluate the assertion against the whole video via Gemini's Files API. Useful for ephemeral UI (toasts, snackbars) that a single screenshot may miss
  • Redis-Based Step Caching — Cache-first execution with AI fallback and automatic self-healing when cached steps fail
  • Configurable AI Models — 8 dedicated model slots for step execution, assertions, extraction, and more
  • AI Gateway Support — Route requests through Vercel AI Gateway, OpenRouter, Cloudflare AI Gateway, or connect directly to provider SDKs
  • Dynamic Placeholders — Inject values at runtime with {{run.*}}, {{global.*}}, {{data.*}}, and {{email.*}} expressions for repeatable and data-driven tests
  • Email Extraction — Pluggable email provider interface with a built-in emailsink provider
  • AI-Powered Data Extraction — Extract structured values from page snapshots and URLs using AI
  • Smart Wait Conditions — AI-evaluated wait conditions with exponential backoff. No rigid selectors or time-based waits needed.
  • Secure Script Runner — AST-validated Playwright script execution with an allowlisted API surface
  • Telemetry — Optional Axiom and OpenTelemetry tracing via environment variables
  • Structured Logging — Pino-based logger with configurable log levels
  • Global Configuration — Single configure() entry point for models, gateway, email provider, and upload path

Core Functions

runSteps(options: RunStepsOptions)

Executes a sequence of steps using AI with caching. Each step is described in natural language and executed via Playwright.

await runSteps({
  page,
  userFlow: "Checkout Flow",
  steps: [
    { description: "Add item to cart" },
    { description: "Go to checkout" },
    { description: "Fill in shipping details", data: { value: "123 Main St" } },
  ],
  assertions: [{ assertion: "Order confirmation is displayed" }],
  test,
  expect,
});

runUserFlow(options: UserFlowOptions)

Runs a complete user flow as a single AI agent call. Best for exploratory testing where exact steps are flexible.

const result = await runUserFlow({
  page,
  userFlow: "Complete a purchase",
  steps: "Navigate to store, add an item, checkout with test card",
  effort: "high", // by default "low" uses gemini-3-flash for faster execution; "high" uses gemini-3.1-pro-preview for deeper thinking
});

assert(options: AssertionOptions)

Multi-model consensus assertion. Runs Claude and Gemini in parallel; if they disagree, a third model arbitrates (configurable — see Consensus Policy).

const result = await assert({
  page,
  assertion: "The dashboard shows 3 active projects",
  expect,
});

Consensus Policy

When the primary (Claude) and secondary (Gemini) assertion models reach the same verdict, the result is used directly. When they disagree, you choose how Passmark resolves it:

Policy Behavior
consult-arbiter-on-disagreement (default) Calls the arbiter model (Gemini 3.1 Pro) to break the tie.
fail-on-disagreement Treats any disagreement as a failure immediately — no arbiter call. The returned reasoning includes both models' takes so you can inspect what they saw differently.

Pick fail-on-disagreement when you'd rather surface ambiguity/flakiness in the UI under test than let a single model swing the result. Pick the default when you trust the arbiter to make the final call.

configure({
  assertions: {
    consensusPolicy: "fail-on-disagreement",
  },
});

Video Assertions

For UI that's only visible for a second or two — toast messages, snackbar confirmations, transient banners — a single end-of-flow screenshot often misses the evidence. Set video: true on an assertion inside runSteps and Passmark will record the entire step run with page.screencast, upload the resulting .webm to Gemini's Files API, and evaluate the assertion against the full video:

await runSteps({
  page,
  userFlow: "Add to cart",
  steps: [
    { description: "Click Acme Circles T-Shirt" },
    { description: "Add to cart" },
  ],
  assertions: [
    { assertion: "An 'Added to cart' toast appears", video: true },
  ],
  test,
  expect,
});

Notes:

  • Recording spans the entire step run (start of first step to end of last step). One recording is shared across all video: true assertions in the same runSteps call.
  • The video file is written to /tmp/passmark-recordings/ by default and deleted automatically after the assertions consume it. Override via configure({ videoDir: "/your/path" }).
  • This path uses only Gemini (no Claude/Gemini consensus) since Claude doesn't accept video. The model is gemini-3-flash-preview.
  • Video assertions go directly to Gemini's Files API regardless of any configured gateway — file URIs are tied to the uploading Google account, so the gateway can't proxy them. You must set GOOGLE_GENERATIVE_AI_API_KEY (or GEMINI_API_KEY) even when the rest of your stack runs through Vercel / OpenRouter / Cloudflare.
  • If page.screencast.start() fails (rare), video assertions silently fall back to the regular screenshot/snapshot path so the run still completes.

Configuration

Call configure() once before using any functions:

import { configure } from "passmark";

configure({
  ai: {
    gateway: "none", // "none" (default), "vercel", "openrouter", "opencodezen", or "cloudflare"
    models: {
      stepExecution: "google/gemini-3-flash",
      utility: "google/gemini-2.5-flash",
    },
  },
  uploadBasePath: "./uploads",
});

Environment Variables

Variable Required Default Description
REDIS_URL No - Redis connection URL for step caching and global state. Can also be set via configure({ redis: { url } }), which takes precedence.
ANTHROPIC_API_KEY Yes - Anthropic API key for Claude models
GOOGLE_GENERATIVE_AI_API_KEY Yes - Google API key for Gemini models. Also required for video: true assertions regardless of gateway (file URIs are tied to the uploading account).
OPENAI_API_KEY No - OpenAI API key for OpenAI models (required for CUA mode; must have Responses-API computer tool access)
AI_GATEWAY_API_KEY If gateway=vercel - Vercel AI Gateway API key
OPENROUTER_API_KEY If gateway=openrouter - OpenRouter API key
OPENCODEZEN_API_KEY If gateway=opencodezen - OpenCode Zen API key
CLOUDFLARE_ACCOUNT_ID If gateway=cloudflare - Cloudflare account ID that owns the AI Gateway
CLOUDFLARE_AI_GATEWAY If gateway=cloudflare - Cloudflare AI Gateway name (slug)
CLOUDFLARE_AI_GATEWAY_API_KEY If gateway=cloudflare and the gateway is authenticated - Cloudflare AI Gateway token (sent as cf-aig-authorization)
AXIOM_TOKEN No - Axiom token for OpenTelemetry tracing. Can also be set via configure({ telemetry: { axiomToken } }), which takes precedence.
AXIOM_DATASET No - Axiom dataset for trace storage. Can also be set via configure({ telemetry: { axiomDataset } }), which takes precedence.
PASSMARK_LOG_LEVEL No info Log level: debug, info, warn, error, silent

Model Configuration

All models are configurable via configure({ ai: { models: { ... } } }):

Key Default Used For
stepExecution google/gemini-3-flash Executing individual steps
userFlowLow google/gemini-3-flash-preview User flow execution (low effort)
userFlowHigh google/gemini-3.1-pro-preview User flow execution (high effort)
assertionPrimary anthropic/claude-4.5-haiku Primary assertion model (Claude)
assertionSecondary google/gemini-3-flash Secondary assertion model (Gemini)
assertionArbiter google/gemini-3.1-pro-preview Arbiter for assertion disagreements
utility google/gemini-2.5-flash Data extraction, wait conditions
cua gpt-5.5 CUA mode — OpenAI Responses API with the built-in computer tool

Caching

Passmark caches successful step actions in Redis. On subsequent runs, cached steps execute directly without AI calls, dramatically reducing latency and cost.

Provide the connection via configure({ redis: { url } }) or the REDIS_URL env var (configure value wins). Without either, caching, {{global.*}} placeholders, and project data are disabled.

  • Steps are cached by userFlow + step.description
  • Set bypassCache: true on individual steps or the entire run to force AI execution
  • Cache is automatically bypassed on Playwright retries
  • Caching only applies to runSteps. As of now, only those AI executions that are single-step are cached as multi-step actions can vary widely and are less likely to be identical on subsequent runs. We're exploring ways to safely cache multi-step flows.

Telemetry

Telemetry is opt-in. Either set the AXIOM_TOKEN and AXIOM_DATASET env vars, or pass them through configure():

configure({
  telemetry: {
    axiomToken: process.env.MY_AXIOM_TOKEN,
    axiomDataset: "passmark-traces",
  },
});

configure() values take precedence over env vars. Without either, telemetry is a no-op. All AI calls are wrapped with withSpan for observability.

Configure Axiom to get a rich dashboard like this:

Axiom Dashboard

Email Extraction

Configure an email provider for testing flows that involve email verification. By default, you can use the emailsink provider, which provides disposable email addresses and an API to fetch received emails. The free tier doesn't need any credentials, but for more reliability and flexible rate limits, you can sign up for an account and use your EMAILSINK_API_KEY. Reach out to us if you want to get an API key.

import { configure } from "passmark";
import { emailsinkProvider } from "passmark/providers/emailsink";

configure({
  email: emailsinkProvider({ apiKey: process.env.EMAILSINK_API_KEY }),
});

Or implement a custom provider:

configure({
  email: {
    domain: "my-test-mail.com",
    extractContent: async ({ email, prompt }) => {
      // Fetch and extract content from your email service
      return extractedValue;
    },
  },
});

Use in steps with the {{email.*}} placeholder pattern:

{
  description: "Enter the verification code",
  data: { value: "{{email.otp:get the 6 digit verification code:{{run.dynamicEmail}}}}" }
}

Placeholder System

Dynamic values can be injected into step data using placeholders:

Pattern Scope Description
{{run.email}} Single test Random email (faker)
{{run.dynamicEmail}} Single test Email using configured domain
{{run.fullName}} Single test Random full name
{{run.shortid}} Single test Short unique ID
{{run.phoneNumber}} Single test Random phone number
{{global.email}} All tests in an execution Shared across runSteps calls with same executionId
{{global.dynamicEmail}} All tests in an execution Shared dynamic email
{{data.key}} Per project Stored in Redis, managed via project settings
{{email.type:prompt}} Resolved lazily Extract content from received email

Architecture Overview

Step Request
    |
    v
[Cache Check] --hit--> [Execute Cached Action] --success--> Done
    |                          |
    miss                     fail (auto-heal)
    |                          |
    v                          v
[AI Execution] ---------> [Cache Result]
    |
    v
[Assertions] (Claude + Gemini consensus)

Known Limitations

  • Tests are not comprehensive at the moment. We welcome contributions to expand test coverage, especially around edge cases and failure modes.

Contributing

See CONTRIBUTING.md for development setup, code style, and PR workflow.

License

FSL-1.1-Apache-2.0 - Functional Source License, Version 1.1, with Apache 2.0 future license.

관련 저장소
openclaw/openclaw

Your own personal AI assistant. Any OS. Any Platform. The lobster way. 🦞

TypeScriptnpmOtheraiassistant
openclaw.ai
383.7k80.6k
obra/superpowers

An agentic skills framework & software development methodology that works.

ShellMIT Licenseaibrainstorming
258.9k23.1k
NousResearch/hermes-agent

The agent that grows with you

PythonPyPIMIT Licenseaiai-agent
hermes-agent.nousresearch.com
218.5k41.3k
n8n-io/n8n

Fair-code workflow automation platform with native AI capabilities. Combine visual building with custom code, self-host or cloud, 400+ integrations.

TypeScriptnpmOtherautomationipaas
n8n.io
197.4k59.5k
Significant-Gravitas/AutoGPT

AutoGPT is the vision of accessible AI for everyone, to use and to build on. Our mission is to provide the tools, so that you can focus on what matters.

PythonPyPIOtheraiopenai
agpt.co
185.6k46.1k
f/prompts.chat

f.k.a. Awesome ChatGPT Prompts. Share, discover, and collect prompts from the community. Free and open source — self-host for your organization with complete privacy.

HTMLOtherchatgptai
prompts.chat
166.2k21.5k
AUTOMATIC1111/stable-diffusion-webui

Stable Diffusion web UI

PythonPyPIGNU Affero General Public License v3.0deep-learningdiffusion
164.3k30.4k
Snailclimb/JavaGuide

Java 面试 & 后端通用面试指南,覆盖计算机基础、数据库、分布式、高并发、系统设计与 AI 应用开发

JavaScriptnpmApache License 2.0javainterview
javaguide.cn
157.2k46.2k
firecrawl/firecrawl

The API to search, scrape, and interact with the web at scale. 🔥

TypeScriptnpmGNU Affero General Public License v3.0aicrawler
firecrawl.dev
154.1k8.8k
langgenius/dify

Build Agentic workflows, RAG pipelines, with rich AI model and tool support on one collaborative workspace. Deploy on cloud, VPC, or self-hosted, so teams move from prototype to production without rebuilding the stack.

TypeScriptnpmOtheraigpt
dify.ai
149.7k23.6k
open-webui/open-webui

User-friendly AI Interface (Supports Ollama, OpenAI API, ...)

PythonPyPIOtherollamaollama-webui
openwebui.com
146.3k21.2k
langchain-ai/langchain

The agent engineering platform.

PythonPyPIMIT Licenseaianthropic
docs.langchain.com/langchain/
142.3k23.7k