返回排行榜

OBenner/data-engineering-interview-questions

Python

More than 2000+ Data engineer interview questions.

data-engineeringinterview-questionsinterviewhadoophadoop-hdfssparkflinksqlkafkahiveimpalaairflow
Star 增长趋势
Star
1.7k
Forks
556
周增长
Issues
2
5001k1.5k
2021年8月2023年3月2024年11月2026年7月
制品库PyPIpip install data-engineering-interview-questions
README

More than 2000+ questions for preparing a Data Engineer interview.

Full list of questions

Pick a topic below or use the full list to practice end-to-end.

Interview questions for Data Engineer

Databases and Data Warehouses
GitHub Repo Official page Questions Description Useful links
Cassandra Cassandra Apache Cassandra Cassandra is a distributed, wide-column store, NoSQL database management system. Awesome Cassandra
Greenplum Greenplum Greenplum Greenplum is a big data technology based on MPP architecture and the Postgres open source database technology. Awesome Greenplum
MongoDB MongoDB MongoDB MongoDB is a document-oriented database. Awesome MongoDB
Hbase Hbase Apache Hbase HBase is an open-source non-relational distributed database. Awesome HBase
Hive Hive Apache Hive Apache Hive is a data warehouse software project built on top of Apache Hadoop for providing data query and analysis. Awesome Hive
Amazon DynamoDB Amazon DynamoDB Amazon DynamoDB is a fully managed proprietary NoSQL database service. Awesome DynamoDB Awesome AWS
Amazon Redshift Amazon Redshift Amazon Redshift is a data warehouse product. Amazon Redshift Utilities Awesome AWS
BigQuery BigQuery GCP BigQuery is a fully-managed, serverless data warehouse. Awesome BigQuery
Bigtable Bigtable GCP Bigtable is a fully managed wide-column and key-value NoSQL database service. Awesome Bigtable
Data Formats
Avro Avro Apache Avro Avro is a row-oriented remote procedure call and data serialization framework. Awesome Avro
Parquet Parquet Apache Parquet Apache Parquet is a column-oriented data file format designed for efficient data storage and retrieval. Parquet format · Docs
Delta Delta Delta Delta Lake is a storage framework that enables building a Lakehouse architecture with compute engines Delta examples
Iceberg Iceberg Apache Iceberg Apache Iceberg is an open table format for huge analytic datasets. Iceberg docs
Hudi Hudi Apache Hudi Apache Hudi brings upserts, deletes, and incremental processing to data lakes. Hudi docs
Big Data Frameworks
Airflow Airflow Apache Airflow Apache Airflow is a workflow management platform for data engineering pipelines. Awesome Airflow
Flume Flume Apache Flume Apache Flume is a distributed, reliable, and available software for efficiently collecting, aggregating, and moving large amounts of log data. Flume User Guide
Hadoop Hadoop Apache Hadoop Apache Hadoop is a collection of software utilities that facilitates using a network of many computers to solve problems involving massive amounts of data and computation. Awesome Hadoop
Impala Impala Apache Impala Apache Impala is a parallel processing SQL query engine for data stored in a computer cluster running Apache Hadoop. Impala docs
Kafka Kafka Apache Kafka Apache Kafka is a distributed event store and stream-processing platform. Awesome Kafka
NiFi NiFi Apache NiFi Apache NiFi is a software project designed to automate the flow of data between software systems. Awesome NiFi
Spark Spark Apache Spark Apache Spark is unified analytics engine for large-scale data processing. Awesome Spark
Flink Flink Apache Flink Apache Flink is unified stream-processing and batch-processing framework. Awesome Flink
Kubernetes Kubernetes Kubernetes Kubernetes is a system for managing containerized applications across multiple hosts. Awesome Kubernetes
Cloud providers
AWS AWS Amazon Web Services Amazon web service is an online platform that provides scalable and cost-effective cloud computing solutions. Awesome AWS
Azure Azure Microsoft Azure Microsoft Azure is Microsoft's public cloud computing platform. Awesome Azure
GCP GCP Google Cloud Platform Google Cloud Platform is a suite of cloud computing services. Awesome GCP
Modern Data Stack
dbt dbt dbt dbt is a transformation framework for building tested and documented SQL models. dbt tests
Theory
DWHA DWH Architectures A data warehouse architecture is a method of defining the overall architecture of data communication processing and presentation that exist for end-clients computing within the enterprise. Awesome databases
CDC Change Data Capture (CDC) CDC captures inserts/updates/deletes from source systems for low-latency ingestion. Debezium docs
Data Modeling Data Modeling Dimensional modeling concepts used to build reliable analytics datasets. Kimball Group
Data Quality Data Quality Tests, monitoring, and practices to ensure datasets are trusted and correct. Great Expectations docs
Data Observability Data Observability Monitoring and incident response practices for pipeline and dataset health. OpenLineage
Data Governance Data Governance Ownership, policies, privacy, and access controls for data platforms. DataHub
Cost Optimization Cost Optimization Practical techniques to reduce compute and storage costs while meeting SLAs. Spark tuning
Python Python for Data Engineering Python fundamentals for reliable, scalable data pipelines and tooling. PyArrow docs
System Design Data System Design System design interview questions for batch/streaming data platforms. Data mesh overview
Airflow Data Structures A data structure is a specialized format for organizing, processing, retrieving and storing data. Awesome Algorithms
SQL SQL SQL is a domain-specific language used in programming and designed for managing data held in a relational database management system (RDBMS). Awesome SQL
Data visualization tools/BI
Tableau Tableau Tableau is a powerful data visualization tool used in the Business Intelligence. Tableau Desktop docs
Looker Looker Looker is an enterprise platform for BI, data applications, and embedded analytics that helps you explore and share insights in real time. Looker docs
Kafka Apache Superset Apache Superset Superset is a modern data exploration and data visualization platform Superset docs

Contribution

Please contribute to this repository to help it make better. Any change like new question, code improvement, doc improvement etc is very welcome.

See CONTRIBUTING.md for quick checks and guidelines.

相关仓库
apache/superset

Apache Superset is a Data Visualization and Data Exploration Platform

PythonPyPIApache License 2.0supersetapache
superset.apache.org
73.9k17.9k
GokuMohandas/Made-With-ML

Learn how to develop, deploy and iterate on production-grade ML applications.

Jupyter NotebookMIT Licensemachine-learningdeep-learning
madewithml.com
48.8k7.7k
apache/airflow

Apache Airflow - A platform to programmatically author, schedule, and monitor workflows

PythonPyPIApache License 2.0airflowapache
airflow.apache.org
46.2k17.4k
DataTalksClub/data-engineering-zoomcamp

Data Engineering Zoomcamp is a free 9-week course on building production-ready data pipelines. The next cohort starts in January 2026. Join the course here 👇🏼

Jupyter Notebookdata-engineeringkafka
airtable.com/appzbS8Pkg9PL254a/shr6oVXeQvSI5HuWD
43.9k8.6k
eugeneyan/applied-ml

📚 Papers & tech blogs by companies sharing their work on data science & machine learning in production.

MIT Licenseapplied-machine-learningproduction
29.9k4k
kestra-io/kestra

Event Driven Orchestration & Scheduling Platform for Mission Critical Applications

JavaMavenApache License 2.0orchestrationdata-orchestration
go.kestra.io/home
27.4k2.8k
PrefectHQ/prefect

Prefect is a workflow orchestration framework for building resilient data pipelines in Python.

PythonPyPIApache License 2.0pythonworkflow
prefect.io
23.5k2.4k
airbytehq/airbyte

Open-source data movement for ELT pipelines and AI agents — from APIs, databases & files to warehouses, lakes, and AI applications. Both self-hosted and Cloud.

PythonPyPIOtherdatapipeline
airbyte.com
21.7k5.3k
Avaiga/taipy

Turns Data and AI algorithms into production-ready web applications in no time.

PythonPyPIApache License 2.0automationdata-engineering
taipy.io
19.3k2k
argoproj/argo-workflows

Workflow Engine for Kubernetes

GoGo ModulesApache License 2.0workflowkubernetes
argo-workflows.readthedocs.io
16.8k3.6k
dagster-io/dagster

An orchestration platform for the development, production, and observation of data assets.

PythonPyPIApache License 2.0data-pipelinesdagster
dagster.io
15.9k2.2k
andkret/Cookbook

The Data Engineering Cookbook

PythonPyPIApache License 2.0data-engineerdata-engineering
learndataengineering.com
15.2k2.7k